1155 patents
Page 41 of 58
Utility
Radiographic Imaging Device, Radiographic Imaging System, Control Method of Radiographic Imaging Device and Program Storage Medium
27 Nov 19
A radiographic imaging device includes: a radiation detector including plural pixels, each including a sensor portion and a switching element; a detection unit that detects a radiation irradiation start if an electrical signal caused by charges generated in the sensor portion satisfies a specific irradiation detection condition, and/or if an electrical signal caused by charges generated in a radiation sensor portion that is different from the sensor portion satisfies a specific irradiation detection condition; and a control unit that determines whether or not noise caused by external disturbance has occurred after the detection unit has detected the radiation irradiation start, and if the noise has occurred, that stops a current operation of the radiation detector, and causes the detection unit to perform detection.
Takeshi KUWABARA, Yoshihiro OKADA, Haruyasu NAKATSUGAWA, Naoyuki NISHINO
Filed: 8 Aug 19
Design
Lens for camera
25 Nov 19
Keita Kamei
Filed: 4 Sep 18
Utility
Endoscope apparatus
25 Nov 19
There is provided an endoscope apparatus which can notify an operator whether or not a forceps elevator is in a reclined state by simple and inexpensive means.
Yasuhiko Morimoto
Filed: 22 Sep 15
Utility
Surgical device, outer tube, endoscope, and treatment tool
25 Nov 19
A surgical device, an outer tube, an endoscope, and a treatment tool that have a compact configuration and achieve high durability are provided.
Takumi Dejima
Filed: 28 Sep 15
Utility
Endoscope
25 Nov 19
A fixing sleeve that is fitted outward on a connecting portion between a connecting pipe and a treatment tool inserting tube for fixation of the connecting portion comprises a cylindrical sleeve body, an arc-shaped portion that is connected to a proximal end side of the sleeve body, is formed to be coaxial with a sleeve center axis of the sleeve body and has a center angle smaller than 180°, and a projection portion that is formed along a peripheral direction of the sleeve center axis on an inner peripheral surface in the arc-shaped portion in a radial inside of the sleeve center axis.
Yasuhiko Morimoto
Filed: 6 Nov 16
Utility
Radiographic image capturing apparatus, radiographic image capturing system, control method of radiographic image capturing apparatus, and control program of radiographic image capturing apparatus
25 Nov 19
Disclosed is a technique capable of enhancing usability of a radiographic image capturing apparatus, system, control method of the radiographic image capturing apparatus and a non-transitory computer readable recording medium recorded with a control program, for a user.
Yasufumi Oda, Jun Enomoto, Ryou Imamura, Takashi Tajima, Kentaro Noma, Takeshi Kuwabara, Tetsuya Tsuji, Hiroaki Yasuda, Haruyasu Nakatsugawa, Takeshi Koishi
Filed: 16 Apr 18
Utility
Insertion device and photoacoustic measurement apparatus
25 Nov 19
The length of an optical fiber from a portion aligned with the rear end of an insertion needle to a fixing portion is a length obtained by adding a predetermined extra length to a linear distance between the rear end of the insertion needle in a case where the insertion needle is located at a protruding position (insertion position) and an optical fiber fixing position of a grip portion.
Dai Murakoshi, Kaku Irisawa
Filed: 20 Sep 17
Utility
Method for producing liposome
25 Nov 19
Disclosed herein are a method for producing a miniaturized liposome on a large production scale, and an apparatus for producing a liposome which is to be used in the above-mentioned method.
Susumu Sugiyama, Naoki Yamada, Shigehisa Sugiyama, Yohei Okubo
Filed: 15 Jun 17
Utility
Gas separation membrane, gas separation membrane module, and gas separation device
25 Nov 19
A gas separation membrane, the gas separation membrane module, and the gas separation device include a first separation layer, and a second separation layer, the first separation layer has an Si/C ratio of 0.3 or less, the Si/C ratio being a ratio of the number of silicon atoms to the number of carbon atoms at the interface of the first separation layer on the second separation layer side, the second separation layer has a maximum value of an F/C ratio of 0.20 or more, the F/C ratio being a ratio of the number of fluorine atoms to the number of carbon atoms, and an Si/C ratio of 0.3 or less in a portion where the F/C ratio is maximum.
Yusuke Mochizuki, Atsushi Mukai, Motoi Harada, Makoto Sawada
Filed: 11 Nov 18
Utility
Polymer, composition, optical film, and liquid crystal display device
25 Nov 19
A polymer having a partial structure formed by performing radical polymerization with respect to a compound having a mesogenic group derived from at least one type of liquid crystal compound selected from a rod-like liquid crystal compound and a disk-like liquid crystal compound, and two or more polymerizable groups, in which the polymer is a branched polymer, and a composition containing the polymer, an optical film, and a liquid crystal display device.
Akio Tamura, Jun Takeda, Yuki Matsuda, Nobuyuki Akutagawa
Filed: 11 Jan 17
Utility
Coloring composition for textile printing, textile printing method, ink for ink jet textile printing, and dyed fabric
25 Nov 19
Provided are: a coloring composition for dyeing including a compound represented by Formula (1) shown in this specification or a salt thereof; a coloring composition for textile printing in which the coloring composition for dyeing is used for textile printing; a compound which is preferable as a material of the coloring compositions; a textile printing method in which the above-described coloring composition for textile printing is used; an ink for ink jet textile printing including the above-described coloring composition for textile printing; and a dyed fabric.
Kazunari Yagi, Keiichi Tateishi, Takashi Iizumi, Akihiro Hakamata, Yoshihiko Fujie
Filed: 10 May 17
Utility
Magnetic tape device, magnetic reproducing method, and head tracking servo method
25 Nov 19
Provided is a magnetic tape device in which a magnetic tape transportation speed is equal to or lower than 18 m/sec, Ra measured regarding a surface of a magnetic layer of a magnetic tape is equal to or smaller than 2.0 nm, a C—H derived C concentration calculated from a C—H peak area ratio of C1s spectra obtained by X-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is 45 to 65 atom %, and ΔSFD (=SFD25°C.−SFD−190° C.) in a longitudinal direction of the magnetic tape is equal to or smaller than 0.50, with the SFD25° C. being SFD measured in a longitudinal direction of the magnetic tape at a temperature of 25° C., and the SFD−190° C. being SFD measured at a temperature of −190° C.
Norihito Kasada, Eiki Ozawa
Filed: 14 Oct 18
Utility
Touch panel
25 Nov 19
A conductive component includes: a first electrode pattern which is made of metal thin wires, the first electrode pattern including a plurality of first conductive patterns that extend in a first direction.
Hiroshige Nakamura, Tadashi Kuriki
Filed: 5 Sep 18
Utility
Culture method for pluripotent stem cells
25 Nov 19
A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 μM in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.
Yuta Murakami, Sanae Nomiyama, Keita Hagiya, Yuichi Yoshino, Rie Hando, Yoshihide Iwaki, Tasuku Sasaki
Filed: 8 Mar 16
Utility
Zoom lens and imaging apparatus
25 Nov 19
A zoom lens is constituted by, in order from the object side: a positive first lens group; a negative second lens group; a positive third lens group; a positive fourth lens group; a negative fifth lens group, and a positive sixth lens group.
Taiga Noda
Filed: 15 Oct 18
Utility
Instant film pack and device using the same
25 Nov 19
The film cover constituting the instant film pack includes a cover member, a pair of accompanying prevention ribs, a pair of outer light shielding ribs, and a pair of inner light shielding ribs.
Yuki Nakai, Kenji Sugiyama
Filed: 7 Feb 18
Utility
Projection lens and projector
25 Nov 19
A first holding member holds a first optical system and a first mirror, and has a first junction surface.
Yasuto Kuroda
Filed: 15 Nov 18
Utility
Pattern forming method, photo mask manufacturing method, and electronic device manufacturing method
25 Nov 19
Hidehiro Mochizuki, Shuji Hirano, Akira Takada
Filed: 27 Sep 17
Utility
Endoscope System and Method of Operating Same
20 Nov 19
An endoscope system includes at least any one of a processor device that is attachable to and detachable from an endoscope or a light source device that is attachable to and detachable from the endoscope.
Shingo MASUNO, Yusuke KURIOKA
Filed: 29 Jul 19
Utility
Packaging Container, Blood Test Kit, and Blood Analysis Method
20 Nov 19
Osamu NOGUCHI, Yasuko HAMAMOTO
Filed: 22 Apr 19