517 patents
Page 18 of 26
Utility
Method for producing liposome
25 Nov 19
Disclosed herein are a method for producing a miniaturized liposome on a large production scale, and an apparatus for producing a liposome which is to be used in the above-mentioned method.
Susumu Sugiyama, Naoki Yamada, Shigehisa Sugiyama, Yohei Okubo
Filed: 15 Jun 17
Utility
Gas separation membrane, gas separation membrane module, and gas separation device
25 Nov 19
A gas separation membrane, the gas separation membrane module, and the gas separation device include a first separation layer, and a second separation layer, the first separation layer has an Si/C ratio of 0.3 or less, the Si/C ratio being a ratio of the number of silicon atoms to the number of carbon atoms at the interface of the first separation layer on the second separation layer side, the second separation layer has a maximum value of an F/C ratio of 0.20 or more, the F/C ratio being a ratio of the number of fluorine atoms to the number of carbon atoms, and an Si/C ratio of 0.3 or less in a portion where the F/C ratio is maximum.
Yusuke Mochizuki, Atsushi Mukai, Motoi Harada, Makoto Sawada
Filed: 11 Nov 18
Utility
Polymer, composition, optical film, and liquid crystal display device
25 Nov 19
A polymer having a partial structure formed by performing radical polymerization with respect to a compound having a mesogenic group derived from at least one type of liquid crystal compound selected from a rod-like liquid crystal compound and a disk-like liquid crystal compound, and two or more polymerizable groups, in which the polymer is a branched polymer, and a composition containing the polymer, an optical film, and a liquid crystal display device.
Akio Tamura, Jun Takeda, Yuki Matsuda, Nobuyuki Akutagawa
Filed: 11 Jan 17
Utility
Coloring composition for textile printing, textile printing method, ink for ink jet textile printing, and dyed fabric
25 Nov 19
Provided are: a coloring composition for dyeing including a compound represented by Formula (1) shown in this specification or a salt thereof; a coloring composition for textile printing in which the coloring composition for dyeing is used for textile printing; a compound which is preferable as a material of the coloring compositions; a textile printing method in which the above-described coloring composition for textile printing is used; an ink for ink jet textile printing including the above-described coloring composition for textile printing; and a dyed fabric.
Kazunari Yagi, Keiichi Tateishi, Takashi Iizumi, Akihiro Hakamata, Yoshihiko Fujie
Filed: 10 May 17
Utility
Magnetic tape device, magnetic reproducing method, and head tracking servo method
25 Nov 19
Provided is a magnetic tape device in which a magnetic tape transportation speed is equal to or lower than 18 m/sec, Ra measured regarding a surface of a magnetic layer of a magnetic tape is equal to or smaller than 2.0 nm, a C—H derived C concentration calculated from a C—H peak area ratio of C1s spectra obtained by X-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is 45 to 65 atom %, and ΔSFD (=SFD25°C.−SFD−190° C.) in a longitudinal direction of the magnetic tape is equal to or smaller than 0.50, with the SFD25° C. being SFD measured in a longitudinal direction of the magnetic tape at a temperature of 25° C., and the SFD−190° C. being SFD measured at a temperature of −190° C.
Norihito Kasada, Eiki Ozawa
Filed: 14 Oct 18
Utility
Touch panel
25 Nov 19
A conductive component includes: a first electrode pattern which is made of metal thin wires, the first electrode pattern including a plurality of first conductive patterns that extend in a first direction.
Hiroshige Nakamura, Tadashi Kuriki
Filed: 5 Sep 18
Utility
Culture method for pluripotent stem cells
25 Nov 19
A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 μM in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.
Yuta Murakami, Sanae Nomiyama, Keita Hagiya, Yuichi Yoshino, Rie Hando, Yoshihide Iwaki, Tasuku Sasaki
Filed: 8 Mar 16
Utility
Zoom lens and imaging apparatus
25 Nov 19
A zoom lens is constituted by, in order from the object side: a positive first lens group; a negative second lens group; a positive third lens group; a positive fourth lens group; a negative fifth lens group, and a positive sixth lens group.
Taiga Noda
Filed: 15 Oct 18
Utility
Instant film pack and device using the same
25 Nov 19
The film cover constituting the instant film pack includes a cover member, a pair of accompanying prevention ribs, a pair of outer light shielding ribs, and a pair of inner light shielding ribs.
Yuki Nakai, Kenji Sugiyama
Filed: 7 Feb 18
Utility
Projection lens and projector
25 Nov 19
A first holding member holds a first optical system and a first mirror, and has a first junction surface.
Yasuto Kuroda
Filed: 15 Nov 18
Utility
Pattern forming method, photo mask manufacturing method, and electronic device manufacturing method
25 Nov 19
Hidehiro Mochizuki, Shuji Hirano, Akira Takada
Filed: 27 Sep 17
Utility
Antifogging film
18 Nov 19
An antifogging film includes a film base and a saponified layer.
Yui Matsuura, Syougo Katano, Toshiya Mita, Akihiro Ikeyama
Filed: 12 Mar 18
Utility
Method of manufacturing hard coat film
18 Nov 19
An aspect of the present invention relates to method of manufacturing a hard coat film, wherein the hard coat film comprises a plastic substrate and a hard coat layer, the method comprises forming the hard coat layer by subjecting a photopolymerizable hard coating composition to photopolymerization processing, and the photopolymerizable hard coating composition comprises a radical polymerizable compound having two or more radical polymerizable groups selected from the group consisting of acryloyloxy groups, acryloyl groups, methacryloyloxy groups, and methacryloyl groups per molecule, a cationic polymerizable compound, a radical photopolymerization initiator, and a cationic photopolymerization initiator.
Akio Tamura, Katsuyuki Takada, Takayasu Yamazaki, Keisuke Oku, Keigo Ueki
Filed: 11 Oct 17
Utility
Polymer molding composition, wavelength converter, backlight unit, and liquid crystal display device
18 Nov 19
A composition and a wavelength converter are provided.
Naoyoshi Yamada
Filed: 19 Nov 17
Utility
Cell culture device and cell culture method
18 Nov 19
A culture container has a first inflow port and a first outflow port.
Hideaki Kagawa, Shun Goto, Souichi Kohashi, Hidekazu Yamazaki
Filed: 13 Jul 17
Utility
Wavelength conversion laminated film
18 Nov 19
The wavelength conversion laminated film includes a laminate which has a wavelength conversion layer containing a phosphor and a gas barrier layer laminated on both the main surfaces of the wavelength conversion layer and an end face sealing layer which covers at least end faces of the wavelength conversion layer among end faces of the laminate, in which the end face sealing layer includes, from the side of the end faces of the laminate, a first metal layer coming into contact with the end faces, a resin layer, and a second metal layer in this order.
Satoshi Kuniyasu, Tatsuya Oba, Masayuki Kusumoto
Filed: 17 Apr 18
Utility
Transparent film, transparent screen, image display system, and transparent poster
18 Nov 19
Provided are a transparent film that allows scenery to be observed without color unevenness in a state where light is not irradiated, a transparent screen and an image display system including the transparent film, and a transparent poster.
Yujiro Yanai, Michio Nagai, Akira Yamamoto
Filed: 20 Nov 18
Utility
Laminate and image display device
18 Nov 19
An object of the invention is to provide a novel laminate and a novel image display device which have both of a gas barrier function and a polarizer function and have a reduced thickness as compared to those in the related art.
Junichi Hirakata, Yuya Hamaguchi
Filed: 17 Jul 17
Utility
Imaging lens and imaging apparatus
18 Nov 19
The imaging lens consists of a first lens group fixed to an image plane during focusing, an aperture stop, a second lens group having a positive refractive power which moves along an optical axis during focusing, and a third lens group fixed to the image plane during focusing, in order from an object side.
Hiroki Saito, Shunsuke Miyagishima
Filed: 16 Jan 18
Utility
Head up display apparatus
18 Nov 19
An optical filter having spectral properties that reflects light of a first wavelength band and transmits light of a second wavelength band that does not include the first wavelength band is provided between a greater distance optical system that displays a virtual image at a greater distance from an image reflection surface and a closer distance optical system that displays a virtual image at a closer distance from the image reflection surface.
Masanao Kawana
Filed: 19 Dec 16